PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK23416.2

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

NAC

Protein Properties

Length: 51aa MW: 5860.67 Da PI: 10.2329

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK23416.2	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	51.1	4.4e-16	13	50	56	93
NAM 56 kewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 + wyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++ PK23416.2 13 SLWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIY 50 379*********************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	19.164	1	51	IPR003441	NAC domain
SuperFamily	SSF101941	1.09E-14	14	50	IPR003441	NAC domain
Pfam	PF02365	4.3E-5	15	47	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
WVAMAMAGDD ELSLWYFFSH KDKKYPTGTR TNRATKAGFW KATGRDKAIY A

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:25148240}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001319296.1	1e-21	NAC (No apical meristem) domain transcriptional regulator superfamily protein
Refseq	NP_176457.1	1e-21	NAC (No apical meristem) domain transcriptional regulator superfamily protein
Swissprot	F4HYV5	1e-22	NAC26_ARATH; NAC domain-containing protein 26
TrEMBL	A0A1J3I0Y0	4e-20	A0A1J3I0Y0_NOCCA; NAC domain-containing protein 7 (Fragment)
TrEMBL	A0A371GKK0	5e-20	A0A371GKK0_MUCPR; NAC domain-containing protein 7 (Fragment)
STRING	AT1G62700.1	5e-21	(Arabidopsis thaliana)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G62700.1	5e-25	Arabidopsis NAC domain containing protein 26

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]