![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK25870.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 129aa MW: 14878.4 Da PI: 9.4915 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 96.4 | 1.9e-30 | 51 | 109 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk+s++pr+YY+C+s gC+vkk+ver++ed ++v++tY g Hnhe
PK25870.1 51 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSGGCNVKKRVERDREDSSYVITTYDGVHNHE 109
69********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 6.0E-33 | 38 | 111 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.45E-28 | 44 | 111 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.997 | 46 | 111 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.1E-33 | 51 | 110 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 9.1E-24 | 52 | 109 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0042742 | Biological Process | defense response to bacterium | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
XNYGCYTDDQ TINSMMIGAT STNTNNKNRK NKMDEVGHRV AFKTKSELEI MDDGFKWRKY 60 GKKSVKNSPN PRNYYKCSSG GCNVKKRVER DREDSSYVIT TYDGVHNHET PGVLYYNQMP 120 LMAPNAWNL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 8e-26 | 39 | 111 | 2 | 74 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007048143.2 | 5e-61 | PREDICTED: probable WRKY transcription factor 51 | ||||
| Swissprot | Q93WU9 | 5e-43 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | A0A2P5EJE3 | 1e-69 | A0A2P5EJE3_TREOI; WRKY domain containing protein | ||||
| STRING | EOX92300 | 7e-60 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1120 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64810.1 | 6e-45 | WRKY DNA-binding protein 51 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




