![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK25933.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 84aa MW: 9624.67 Da PI: 10.5062 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 82 | 6.1e-26 | 41 | 84 | 2 | 45 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSST CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedp 45
dDgy+WrKYGqK++k++++prsYYrCt ++C++kk+vers edp
PK25933.1 41 DDGYKWRKYGQKSIKNTPNPRSYYRCTNPRCNAKKQVERSMEDP 84
8***************************************9996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.3E-24 | 32 | 84 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 23.479 | 35 | 84 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.27E-22 | 36 | 84 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.3E-20 | 40 | 84 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.3E-20 | 41 | 82 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
XPAPASRNSL LERGLMMSSK SIDNKYTLKI KSSATNNGMT DDGYKWRKYG QKSIKNTPNP 60 RSYYRCTNPR CNAKKQVERS MEDP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-17 | 39 | 84 | 16 | 61 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-17 | 39 | 84 | 16 | 61 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017418023.1 | 3e-34 | PREDICTED: probable WRKY transcription factor 49 isoform X2 | ||||
| Swissprot | Q9FHR7 | 2e-27 | WRK49_ARATH; Probable WRKY transcription factor 49 | ||||
| TrEMBL | A0A2P5DS38 | 1e-33 | A0A2P5DS38_TREOI; WRKY domain containing protein | ||||
| STRING | XP_010107303.1 | 9e-33 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7118 | 34 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G43290.1 | 7e-30 | WRKY DNA-binding protein 49 | ||||




