![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK26417.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 62aa MW: 7201.58 Da PI: 4.4169 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 51.5 | 2.9e-16 | 18 | 61 | 12 | 55 |
TGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS
HSF_DNA-bind 12 deelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55
++++ ++isw+e+g+ f+v+ + ef++ +LpkyFkh+nf+SF+R
PK26417.1 18 NNNNGSIISWNEEGDGFIVWSPPEFSELLLPKYFKHNNFSSFIR 61
677889*************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46785 | 2.31E-13 | 17 | 61 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Gene3D | G3DSA:1.10.10.10 | 2.6E-16 | 18 | 61 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 3.3E-13 | 18 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
LELQERTRAV GSNDDHDNNN NGSIISWNEE GDGFIVWSPP EFSELLLPKY FKHNNFSSFI 60 RX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:9645433}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018820155.1 | 2e-20 | PREDICTED: heat stress transcription factor B-2a-like | ||||
| Swissprot | Q652B0 | 6e-14 | HFB2C_ORYSJ; Heat stress transcription factor B-2c | ||||
| Swissprot | Q96320 | 3e-14 | HSFB1_ARATH; Heat stress transcription factor B-1 | ||||
| TrEMBL | A0A2I4EL76 | 4e-19 | A0A2I4EL76_JUGRE; heat stress transcription factor B-2a-like | ||||
| STRING | XP_009352926.1 | 1e-18 | (Pyrus x bretschneideri) | ||||
| STRING | XP_006449329.1 | 1e-18 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11660.1 | 4e-16 | HSF family protein | ||||




