![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK26879.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 96aa MW: 11669 Da PI: 10.1005 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 61.8 | 1e-19 | 3 | 52 | 7 | 56 |
--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
++ +q++ Le+ Fe ++++ e++ +LAk lgL+ rqV +WFqNrRa++k
PK26879.2 3 LSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 52
6789*********************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 130.1 | 8.7e-42 | 2 | 89 | 5 | 92 |
HD-ZIP_I/II 5 rlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
rls +qv++LE+sFe e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkq+Ekdy++L+++y++lk++ e+L+ke+++L++e+k
PK26879.2 2 RLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQMEKDYDVLQASYNSLKADYESLRKETDKLKTEVK 89
9***********************************************************************************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 1.7E-14 | 1 | 58 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 17.167 | 1 | 54 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.91E-19 | 2 | 65 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 1.93E-13 | 2 | 55 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-21 | 3 | 62 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 5.0E-17 | 3 | 52 | IPR001356 | Homeobox domain |
| PRINTS | PR00031 | 1.6E-6 | 25 | 34 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 29 | 52 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 1.6E-6 | 34 | 50 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 7.8E-15 | 54 | 89 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
XRLSVDQVQF LEKSFEVENK LEPERKVQLA KDLGLQPRQV AIWFQNRRAR WKTKQMEKDY 60 DVLQASYNSL KADYESLRKE TDKLKTEVKF HYPFRN |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 46 | 54 | RRARWKTKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. May be involved in the regulation of gibberellin signaling. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | INDUCTION: By gibberellin. Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151, ECO:0000269|PubMed:18049796}. | |||||
| UniProt | INDUCTION: Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010112600.1 | 3e-49 | homeobox-leucine zipper protein HAT5 | ||||
| Swissprot | A2YWC0 | 8e-39 | HOX20_ORYSI; Homeobox-leucine zipper protein HOX20 | ||||
| Swissprot | Q6K498 | 1e-38 | HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4 | ||||
| Swissprot | Q6Z248 | 8e-39 | HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20 | ||||
| Swissprot | Q9XH37 | 1e-38 | HOX4_ORYSI; Homeobox-leucine zipper protein HOX4 | ||||
| TrEMBL | A0A2P5EKJ8 | 2e-51 | A0A2P5EKJ8_TREOI; Octamer-binding transcription factor | ||||
| STRING | XP_010112600.1 | 1e-48 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1500 | 34 | 99 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01470.1 | 2e-40 | homeobox 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




