![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK29334.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 65aa MW: 7353.12 Da PI: 5.8113 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 88.5 | 8.6e-28 | 2 | 65 | 15 | 78 |
DUF260 15 dCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
C++apyf +++pkkfa vhk+FGasnv+k+l ++pee+red+++sl+yeAear+rdPvyG++g
PK29334.1 2 TCIFAPYFRSDEPKKFAKVHKVFGASNVSKILIEVPEEQREDTVNSLAYEAEARLRDPVYGCIG 65
6*************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 18.73 | 1 | 65 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 6.2E-27 | 2 | 65 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
XTCIFAPYFR SDEPKKFAKV HKVFGASNVS KILIEVPEEQ REDTVNSLAY EAEARLRDPV 60 YGCIG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-30 | 3 | 65 | 26 | 88 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-30 | 3 | 65 | 26 | 88 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010067553.1 | 2e-40 | PREDICTED: LOB domain-containing protein 21 | ||||
| Refseq | XP_012457488.1 | 2e-40 | PREDICTED: LOB domain-containing protein 21-like isoform X3 | ||||
| Swissprot | Q9SRL8 | 4e-33 | LBD21_ARATH; LOB domain-containing protein 21 | ||||
| TrEMBL | A0A2P5EM60 | 3e-39 | A0A2P5EM60_TREOI; Lateral organ boundaries domain containing protein | ||||
| STRING | XP_010067552.1 | 8e-40 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5944 | 33 | 53 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G11090.1 | 2e-35 | LOB domain-containing protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




