PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00004377-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 169aa MW: 19944.2 Da PI: 8.8742

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00004377-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	140.1	1.3e-43	25	151	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 pGfrF Pt+eel+++yLkk+v+g + l+l+ +i+++d+y+++Pw+Lp + + +e++w+fF++rd+k++ r+nr t+sgyWkatg+dk++ PSME_00004377-RA 25 PGFRFYPTEEELLSFYLKKRVRGCHqLNLDIIIPTLDLYQYDPWQLPgFANDIGERQWFFFVPRDHKKS-CPRPNRLTASGYWKATGSDKAIR 116 9*******************9885777667***********656667999******986.58******************* PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ + +glkk Lvfykg+ap g+ktdW+m+eyr+ PSME_00004377-RA 117 NELLQCIGLKKFLVFYKGKAPCGRKTDWIMNEYRM 151 99999**************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	44.371	23	169	IPR003441	NAC domain
SuperFamily	SSF101941	8.5E-44	23	153	IPR003441	NAC domain
Pfam	PF02365	5.7E-24	25	151	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MALQEEIHND GKVQGQEIME IMDLPGFRFY PTEEELLSFY LKKRVRGCHQ LNLDIIIPTL 60 DLYQYDPWQL PGFANDIGER QWFFFVPRDH KKSCPRPNRL TASGYWKATG SDKAIRNELL 120 QCIGLKKFLV FYKGKAPCGR KTDWIMNEYR MPDFRLSAPK VTIFPLIFF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-39	25	151	19	142	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-39	25	151	19	142	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-39	25	151	19	142	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-39	25	151	19	142	NO APICAL MERISTEM PROTEIN
3swm_A	4e-39	25	151	22	145	NAC domain-containing protein 19
3swm_B	4e-39	25	151	22	145	NAC domain-containing protein 19
3swm_C	4e-39	25	151	22	145	NAC domain-containing protein 19
3swm_D	4e-39	25	151	22	145	NAC domain-containing protein 19
3swp_A	4e-39	25	151	22	145	NAC domain-containing protein 19
3swp_B	4e-39	25	151	22	145	NAC domain-containing protein 19
3swp_C	4e-39	25	151	22	145	NAC domain-containing protein 19
3swp_D	4e-39	25	151	22	145	NAC domain-containing protein 19
4dul_A	3e-39	25	151	19	142	NAC domain-containing protein 19
4dul_B	3e-39	25	151	19	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020598401.1	2e-55	NAC domain-containing protein 35-like, partial
Swissprot	Q9ZVP8	1e-50	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A075M5N5	7e-84	A0A075M5N5_9SPER; NAC domain protein
STRING	Migut.N00873.1.p	2e-51	(Erythranthe guttata)
STRING	XP_008791987.1	2e-52	(Phoenix dactylifera)
STRING	GSMUA_Achr10P04320_001	7e-52	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	3e-53	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]