PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00004490-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

MYB

Protein Properties

Length: 137aa MW: 15879 Da PI: 10.9705

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00004490-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.6	2.1e-16	19	66	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l +++k +G g W++ +++ g++R++k+c++rw++yl PSME_00004490-RA 19 RGAWTASEDKILSEYIKNHGDGGWRSLSNRAGLKRCAKSCRLRWLNYL 66 89*********************************************7 PP
2	Myb_DNA-binding	55.6	1.2e-17	72	115	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ ++eEdel v+++++lG++ W++Ia +++ gRt++++k++w++ PSME_00004490-RA 72 RGNISPEEDELVVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 115 7999****************.*****.*********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.67	14	66	IPR017930	Myb domain
SuperFamily	SSF46689	1.1E-28	17	113	IPR009057	Homeodomain-like
SMART	SM00717	6.7E-12	18	68	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-15	19	66	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.7E-22	20	72	IPR009057	Homeodomain-like
CDD	cd00167	1.05E-8	21	66	No hit	No description
PROSITE profile	PS51294	26.678	67	121	IPR017930	Myb domain
SMART	SM00717	9.9E-16	71	119	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-15	72	116	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-25	73	121	IPR009057	Homeodomain-like
CDD	cd00167	3.33E-11	76	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
IMGRSPSSSK HDQDRSLNRG AWTASEDKIL SEYIKNHGDG GWRSLSNRAG LKRCAKSCRL 60 RWLNYLRPDI KRGNISPEED ELVVRLHRLL GNRWSLIAGR LPGRTDNEIK NYWNTQLSKR 120 VHKGRLPGRT DNEIKNY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-25	16	121	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KU131218	1e-121	KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022756428.1	4e-63	transcription factor MYB7-like
Refseq	XP_023899027.1	5e-63	transcription factor TT2-like
Swissprot	Q9S9K9	5e-54	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A2H4Z0B0	6e-71	A0A2H4Z0B0_9SPER; R2R3 MYB transcription factor
STRING	XP_004287618.1	2e-62	(Fragaria vesca)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	2e-56	myb domain protein 3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]