![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00005434-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 106aa MW: 11882.5 Da PI: 4.1824 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 21.6 | 3.6e-07 | 31 | 63 | 107 | 139 |
Whirly 107 vnlsvtnslvkgnesfsvPvskaefavlrsllv 139
v l v+ + ++es+s+P++k+efav++s ++
PSME_00005434-RA 31 VLLGVNDRIADVDESVSIPITKGEFAVMQSTFN 63
568899***********************9985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 1.1E-16 | 30 | 102 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 1.2E-16 | 33 | 85 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MWFDTDLRFG SVFFCSDGEP ENVLASSPPR VLLGVNDRIA DVDESVSIPI TKGEFAVMQS 60 TFNFILPYLM GWHAYMDFPK PNESGHLTSG GPIIAKRPDL EWDVPF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 1e-13 | 33 | 104 | 151 | 220 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 1e-13 | 33 | 104 | 151 | 220 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 1e-13 | 33 | 104 | 151 | 220 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 1e-13 | 33 | 104 | 151 | 220 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF083515 | 1e-76 | EF083515.1 Picea sitchensis clone WS02721_C09 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | A9NQE8 | 2e-36 | A9NQE8_PICSI; Uncharacterized protein | ||||
| STRING | XP_008351051.1 | 5e-17 | (Malus domestica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14410.1 | 8e-19 | ssDNA-binding transcriptional regulator | ||||




