![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00007097-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 82aa MW: 9515.79 Da PI: 4.5356 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 128 | 3.2e-40 | 1 | 73 | 30 | 102 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
+k+dedv+misaeaPv+++kace+fi elt+r+w+h+eenkrrtl+k+diaaa++rtdifdflvdivprdelk
PSME_00007097-RA 1 MKSDEDVRMISAEAPVVFAKACEMFINELTMRAWIHTEENKRRTLQKNDIAAAIARTDIFDFLVDIVPRDELK 73
9*********************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-32 | 1 | 69 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.5E-25 | 1 | 69 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-17 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MKSDEDVRMI SAEAPVVFAK ACEMFINELT MRAWIHTEEN KRRTLQKNDI AAAIARTDIF 60 DFLVDIVPRD ELKEDQETHG SY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 5e-40 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 41 | 47 | RRTLQKN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF084647 | 1e-82 | EF084647.1 Picea sitchensis clone WS02719_H11 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020532226.1 | 1e-44 | nuclear transcription factor Y subunit C-2 isoform X1 | ||||
| Refseq | XP_020532230.1 | 1e-44 | nuclear transcription factor Y subunit C-2 isoform X2 | ||||
| Swissprot | Q8LCG7 | 1e-44 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A9NTJ8 | 6e-44 | A9NTJ8_PICSI; Uncharacterized protein | ||||
| STRING | ERM93786 | 5e-44 | (Amborella trichopoda) | ||||
| STRING | Cagra.1310s0011.1.p | 4e-44 | (Capsella grandiflora) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 4e-47 | nuclear factor Y, subunit C2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




