PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00008238-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 186aa MW: 21501 Da PI: 7.1308

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00008238-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	138.2	5.3e-43	29	155	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 +GfrF Pt+eelv++yLkk+++g + l++ ++ i+++diy+++Pw+Lp +++ ek+w+fF++r++k+ r++r t sgyWkatg+d++ PSME_00008238-RA 29 IAGFRFYPTEEELVNFYLKKRIQGGQqLNF-DIlIPTLDIYRYDPWELPgLAIDVAEKQWFFFVPRESKKC--VRPTRLTVSGYWKATGSDRK 118 58*******************9994555.555***********77888999*****99875..7*************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++ e +glkk+Lvfykg+ap +++tdW+m+eyr+ PSME_00008238-RA 119 IRNELLECIGLKKSLVFYKGKAPLAQRTDWIMNEYRM 155 99999**************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	8.89E-42	20	159	IPR003441	NAC domain
PROSITE profile	PS51005	44.713	28	186	IPR003441	NAC domain
Pfam	PF02365	7.0E-24	30	155	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MSNIEPMAMA ILEEIYNDAG AFMGELTVIA GFRFYPTEEE LVNFYLKKRI QGGQQLNFDI 60 LIPTLDIYRY DPWELPGLAI DVAEKQWFFF VPRESKKCVR PTRLTVSGYW KATGSDRKIR 120 NELLECIGLK KSLVFYKGKA PLAQRTDWIM NEYRMPDFSS SLPKIMKKCK LACADEEHGY 180 GVMSDL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-35	23	155	12	142	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-35	23	155	12	142	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-35	23	155	12	142	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-35	23	155	12	142	NO APICAL MERISTEM PROTEIN
3swm_A	3e-35	23	155	15	145	NAC domain-containing protein 19
3swm_B	3e-35	23	155	15	145	NAC domain-containing protein 19
3swm_C	3e-35	23	155	15	145	NAC domain-containing protein 19
3swm_D	3e-35	23	155	15	145	NAC domain-containing protein 19
3swp_A	3e-35	23	155	15	145	NAC domain-containing protein 19
3swp_B	3e-35	23	155	15	145	NAC domain-containing protein 19
3swp_C	3e-35	23	155	15	145	NAC domain-containing protein 19
3swp_D	3e-35	23	155	15	145	NAC domain-containing protein 19
4dul_A	2e-35	23	155	12	142	NAC domain-containing protein 19
4dul_B	2e-35	23	155	12	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012842307.1	3e-50	PREDICTED: putative NAC domain-containing protein 94
Refseq	XP_020598401.1	6e-52	NAC domain-containing protein 35-like, partial
Refseq	XP_020689448.1	9e-51	NAC domain-containing protein 35 isoform X1
Refseq	XP_022897039.1	2e-50	NAC domain-containing protein 35-like
Refseq	XP_028555611.1	5e-52	NAC domain-containing protein 35 isoform X2
Swissprot	Q9ZVP8	2e-49	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A075M5N5	1e-71	A0A075M5N5_9SPER; NAC domain protein
STRING	XP_008382796.1	5e-50	(Malus domestica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	7e-52	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]