![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00011524-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 73aa MW: 8226.27 Da PI: 4.194 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 54.2 | 4.9e-17 | 20 | 66 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeelv++yL +k+ +++++ +i e+d++k+ePwdL
PSME_00011524-RA 20 LPPGFRFHPTDEELVTYYLLNKILDRNFSG-CAIGEADLNKCEPWDLL 66
79*************************999.67*************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.24E-19 | 10 | 69 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 18.714 | 20 | 73 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.4E-9 | 21 | 63 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MESILNPMND GNEAKAHSEL PPGFRFHPTD EELVTYYLLN KILDRNFSGC AIGEADLNKC 60 EPWDLLGTYV TPL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018845593.1 | 3e-23 | PREDICTED: protein CUP-SHAPED COTYLEDON 1-like isoform X1 | ||||
| Refseq | XP_018845594.1 | 3e-23 | PREDICTED: protein CUP-SHAPED COTYLEDON 1-like isoform X2 | ||||
| Swissprot | Q9FRV4 | 3e-20 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
| TrEMBL | A0A218XUC5 | 4e-22 | A0A218XUC5_PUNGR; Uncharacterized protein | ||||
| TrEMBL | A0A2I4GNX1 | 7e-22 | A0A2I4GNX1_JUGRE; protein CUP-SHAPED COTYLEDON 1-like isoform X1 | ||||
| TrEMBL | A0A2I4GNX6 | 7e-22 | A0A2I4GNX6_JUGRE; protein CUP-SHAPED COTYLEDON 1-like isoform X2 | ||||
| TrEMBL | A0A3N6RPV2 | 4e-22 | A0A3N6RPV2_BRACR; Uncharacterized protein | ||||
| STRING | POPTR_0001s40680.1 | 7e-21 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15170.1 | 1e-22 | NAC family protein | ||||




