PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00014181-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

WOX

Protein Properties

Length: 66aa MW: 7636.55 Da PI: 7.6995

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00014181-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	24.9	3.5e-08	18	66	3	46
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHH CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkv 46 + +++tkeq ++L Fe+ +ps++e++ ++++l ++++++V++ PSME_00014181-RA 18 PGWKPTKEQKRTLIPKFESgMVKPSRHEIKTITAQLqefgQVEDANVFY 66 669*************99************99999*99986 PP
2	Wus_type_Homeobox	57.1	4.3e-19	17	66	3	52
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfy 52 ++ W Pt+eQ + L ++sG++ P+++ei+ ita+L+e+G++ed+NVfy PSME_00014181-RA 17 KPGWKPTKEQKRTLIPKFESGMVKPSRHEIKTITAQLQEFGQVEDANVFY 66 677**********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00046	7.2E-6	18	66	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MDGTSSANEE RSWHETKPGW KPTKEQKRTL IPKFESGMVK PSRHEIKTIT AQLQEFGQVE 60 DANVFY

Functional Description ? help Back to Top
Source	Description
UniProt	Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269\|PubMed:15753038, ECO:0000269\|PubMed:17706632, ECO:0000269\|PubMed:20110319, ECO:0000269\|PubMed:21057190, ECO:0000303\|PubMed:21185286}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269\|PubMed:21316593}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017218505.1	2e-15	PREDICTED: WUSCHEL-related homeobox 9-like
Swissprot	Q6X7J4	3e-14	WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBL	D5LMH9	7e-17	D5LMH9_PICAB; Putative wuschel homeobox protein WOX8/9
STRING	XP_004505393.1	3e-14	(Cicer arietinum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33880.1	1e-16	homeobox-3

Publications ? help Back to Top
Wang W, et al. Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice. PLoS Genet., 2014. 10(3): p. e1004154 [PMID:24625559] Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce. J. Exp. Bot., 2014. 65(22): p. 6543-52 [PMID:25205582] Raines T, et al. The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis. Plant J., 2016. 85(1): p. 134-47 [PMID:26662515] Dolzblasz A, et al. Stem Cell Regulation by Arabidopsis WOX Genes. Mol Plant, 2016. 9(7): p. 1028-39 [PMID:27109605] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374]