PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00020635-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 261aa MW: 29459.1 Da PI: 10.0851

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00020635-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	94.7	1.5e-29	49	125	53	128
NAM 53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekewyfF+++d+ky++g+r+n+a+ s yWka g dk++ +k +++ vg+kk Lvfy g+apkg+kt+W+mhey+l PSME_00020635-RA 49 FGEKEWYFFTPHDRKYPNGSRPNKAAGSRYWKAIGADKPINAKgGKKRVGIKKALVFYAGKAPKGSKTNWIMHEYHL 125 4789************************************966777**************************8 PP
2	NAM	84.9	1.6e-26	182	261	2	82
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 ppGfrF+Ptdeelvv+yL+kk + + +++ +i+evd+yk++Pw+L k+ +ekewyfF++rd+ky++g+r++ra+ sgy PSME_00020635-RA 182 PPGFRFSPTDEELVVHYLCKKEALQIIHV-PIIAEVDLYKYDPWQLLDKALFGEKEWYFFTPRDRKYPNGSRPKRAAGSGY 261 9********************999999.88**********86667799********************99998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	30.399	1	150	IPR003441	NAC domain
Pfam	PF02365	2.4E-13	42	125	IPR003441	NAC domain
SuperFamily	SSF101941	2.75E-30	44	127	IPR003441	NAC domain
SuperFamily	SSF101941	8.11E-31	175	261	IPR003441	NAC domain
PROSITE profile	PS51005	31.281	181	261	IPR003441	NAC domain
Pfam	PF02365	2.9E-11	182	261	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 261 aa Download sequence Send to blast
MGDLSSSILR EDSNMLAPSY ACKLPGFVSI RNEADGLLHM LPAVDKTLFG EKEWYFFTPH 60 DRKYPNGSRP NKAAGSRYWK AIGADKPINA KGGKKRVGIK KALVFYAGKA PKGSKTNWIM 120 HEYHLADVSR PARKKGSLRI PSSLCVMGGI KGLGTIRVAI HLEELCKQAR DHCALLVHNQ 180 WPPGFRFSPT DEELVVHYLC KKEALQIIHV PIIAEVDLYK YDPWQLLDKA LFGEKEWYFF 240 TPRDRKYPNG SRPKRAAGSG Y

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-39	45	261	12	154	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-39	45	261	12	154	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-39	45	261	12	154	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-39	45	261	12	154	NO APICAL MERISTEM PROTEIN
3swm_A	2e-39	45	261	15	157	NAC domain-containing protein 19
3swm_B	2e-39	45	261	15	157	NAC domain-containing protein 19
3swm_C	2e-39	45	261	15	157	NAC domain-containing protein 19
3swm_D	2e-39	45	261	15	157	NAC domain-containing protein 19
3swp_A	2e-39	45	261	15	157	NAC domain-containing protein 19
3swp_B	2e-39	45	261	15	157	NAC domain-containing protein 19
3swp_C	2e-39	45	261	15	157	NAC domain-containing protein 19
3swp_D	2e-39	45	261	15	157	NAC domain-containing protein 19
4dul_A	2e-39	45	261	12	154	NAC domain-containing protein 19
4dul_B	2e-39	45	261	12	154	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006434240.1	3e-44	NAC domain-containing protein 2
Swissprot	Q9CAR0	2e-43	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A0D6R3P9	1e-50	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_006434240.1	1e-43	(Citrus clementina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	1e-45	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]