![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00021819-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 150aa MW: 16874.9 Da PI: 6.5285 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 178.4 | 6.7e-56 | 31 | 122 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
reqdrflPian+srimkk++Panaki+kdak+tvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyvepl++yl+kyre
PSME_00021819-RA 31 REQDRFLPIANISRIMKKAVPANAKIAKDAKDTVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMGTLGFEDYVEPLRLYLQKYREK 122
89****************************************************************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.5E-53 | 25 | 129 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.79E-39 | 33 | 129 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.8E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.9E-22 | 64 | 82 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.9E-22 | 83 | 101 | No hit | No description |
| PRINTS | PR00615 | 6.9E-22 | 102 | 120 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MADLASSATS QESPPSEDTN NNSHNQGSNA REQDRFLPIA NISRIMKKAV PANAKIAKDA 60 KDTVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM GTLGFEDYVE PLRLYLQKYR 120 EKIVYSWKKQ QDSDLAHFIG QSRVVQGSLS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-48 | 31 | 121 | 3 | 93 | NF-YB |
| 4awl_B | 2e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT123608 | 1e-162 | BT123608.1 Picea sitchensis clone WS04715_D15 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024369223.1 | 1e-63 | nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
| Refseq | XP_024369224.1 | 1e-63 | nuclear transcription factor Y subunit B-1-like isoform X3 | ||||
| Swissprot | O23310 | 8e-62 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | D5ABK1 | 7e-82 | D5ABK1_PICSI; Uncharacterized protein | ||||
| STRING | PP1S25_89V6.1 | 6e-63 | (Physcomitrella patens) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-64 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




