PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00023072-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 194aa MW: 21997.6 Da PI: 10.3123

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00023072-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	154.8	3.7e-48	36	162	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGfrF Ptdeelvv+yL+kk++++ + + +i+evd+yk++Pw+Lp k+ +ekewyfF++rd+ky++g+r++r++ s Wk+tg dk++++ PSME_00023072-RA 36 PPGFRFFPTDEELVVHYLCKKAASQIILV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPRDRKYPNGSRPKRVAGSRHWKSTGADKPIHA 127 9*********************99888.78***********8777899*********************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+ k Lvfy g+apkg++t+W+mhey+l PSME_00023072-RA 128 KgGKKRVGINKALVFYAGKAPKGSNTNWIMHEYHL 162 966777*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.45E-53	29	164	IPR003441	NAC domain
PROSITE profile	PS51005	50.042	35	187	IPR003441	NAC domain
Pfam	PF02365	6.5E-24	36	162	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MGGIKGLGTI RVAIHLEELC KQARDHCALL VHNQWPPGFR FFPTDEELVV HYLCKKAASQ 60 IILVPIIAEV DLYKYDPWQL PDKALFGEKE WYFFTPRDRK YPNGSRPKRV AGSRHWKSTG 120 ADKPIHAKGG KKRVGINKAL VFYAGKAPKG SNTNWIMHEY HLPDVSRPAR KKGSLRVSWS 180 ISSLLCFESA VLTT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-67	30	178	12	155	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-67	30	178	12	155	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-67	30	178	12	155	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-67	30	178	12	155	NO APICAL MERISTEM PROTEIN
3swm_A	2e-67	30	178	15	158	NAC domain-containing protein 19
3swm_B	2e-67	30	178	15	158	NAC domain-containing protein 19
3swm_C	2e-67	30	178	15	158	NAC domain-containing protein 19
3swm_D	2e-67	30	178	15	158	NAC domain-containing protein 19
3swp_A	2e-67	30	178	15	158	NAC domain-containing protein 19
3swp_B	2e-67	30	178	15	158	NAC domain-containing protein 19
3swp_C	2e-67	30	178	15	158	NAC domain-containing protein 19
3swp_D	2e-67	30	178	15	158	NAC domain-containing protein 19
4dul_A	2e-67	30	178	12	155	NAC domain-containing protein 19
4dul_B	2e-67	30	178	12	155	NAC domain-containing protein 19
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016682926.1	8e-75	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	4e-72	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A0D6R3P9	1e-84	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_010268987.1	4e-74	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	2e-74	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]