![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00026210-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 106aa MW: 12091.7 Da PI: 4.197 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 113.6 | 9.9e-36 | 1 | 72 | 30 | 101 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
+k+dedvkmisa+aPvl+sk+celfil++tlrswlh+eenkr tl+++dia a++r d+ dfl+divprde+
PSME_00026210-RA 1 MKSDEDVKMISAKAPVLFSKSCELFILDVTLRSWLHTEENKRCTLQRNDIAGAISRGDVLDFLLDIVPRDEV 72
9*********************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.8E-26 | 1 | 69 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-11 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 3.86E-21 | 1 | 84 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MKSDEDVKMI SAKAPVLFSK SCELFILDVT LRSWLHTEEN KRCTLQRNDI AGAISRGDVL 60 DFLLDIVPRD EVREVDNGYT DYLPDTPDGF VEEPRIPEKD IPPVEL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 2e-33 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF085083 | 6e-82 | EF085083.1 Picea sitchensis clone WS0296_J03 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024369382.1 | 7e-40 | nuclear transcription factor Y subunit C-2-like | ||||
| Swissprot | Q8LCG7 | 1e-36 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A9NUT0 | 2e-41 | A9NUT0_PICSI; Uncharacterized protein | ||||
| STRING | PP1S315_9V6.3 | 3e-39 | (Physcomitrella patens) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 5e-39 | nuclear factor Y, subunit C2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




