![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00034737-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 81aa MW: 9239.38 Da PI: 6.2208 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 77.6 | 2.1e-24 | 18 | 76 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
F+ k+y++++d+++++++sw ++ nsfvv+++eef+ ++L +yF hsnf+SFvRQLn+Y
PSME_00034737-RA 18 FMVKTYRLVDDPSTNHIVSWGDRHNSFVVWNPEEFSVSILLSYFNHSNFSSFVRQLNTY 76
99********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.7E-25 | 13 | 76 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 3.7E-15 | 14 | 81 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.63E-22 | 17 | 76 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.2E-11 | 18 | 41 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 7.7E-20 | 18 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-11 | 56 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-11 | 69 | 81 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MGESGGFTDA GRLVAAPFMV KTYRLVDDPS TNHIVSWGDR HNSFVVWNPE EFSVSILLSY 60 FNHSNFSSFV RQLNTYVCIL Y |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 7e-15 | 15 | 76 | 1 | 62 | Putative transcription factor |
| 5d5x_B | 7e-15 | 15 | 76 | 1 | 62 | Putative transcription factor |
| 5d5x_E | 7e-15 | 15 | 76 | 1 | 62 | Putative transcription factor |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020596708.1 | 5e-28 | heat stress transcription factor B-4c-like | ||||
| Swissprot | Q9C635 | 3e-26 | HSFB4_ARATH; Heat stress transcription factor B-4 | ||||
| TrEMBL | H9WUJ0 | 2e-27 | H9WUJ0_PINTA; Uncharacterized protein (Fragment) | ||||
| TrEMBL | H9WUJ3 | 2e-27 | H9WUJ3_PINTA; Uncharacterized protein (Fragment) | ||||
| TrEMBL | H9WUJ6 | 2e-27 | H9WUJ6_PINTA; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010530513.1 | 3e-25 | (Tarenaya hassleriana) | ||||
| STRING | evm.model.supercontig_49.32 | 3e-26 | (Carica papaya) | ||||
| STRING | cassava4.1_032852m | 2e-25 | (Manihot esculenta) | ||||
| STRING | Solyc11g064990.1.1 | 2e-25 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46264.1 | 1e-28 | heat shock transcription factor B4 | ||||




