![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00037043-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 74aa MW: 8759.13 Da PI: 10.6628 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 57.9 | 3.4e-18 | 22 | 70 | 80 | 128 |
NAM 80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
yWkatg+d+++ ++ e +glkk+Lvfykg+ap g++tdW+m+eyr+
PSME_00037043-RA 22 PDYWKATGSDRKIRNELLECIGLKKSLVFYKGKAPLGQRTDWIMNEYRV 70
569************99999***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 21.055 | 1 | 74 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.6E-8 | 19 | 70 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.35E-15 | 22 | 73 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MLRRNNCSSS FQERVRNACG LPDYWKATGS DRKIRNELLE CIGLKKSLVF YKGKAPLGQR 60 TDWIMNEYRV RHPR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020598401.1 | 2e-17 | NAC domain-containing protein 35-like, partial | ||||
| Refseq | XP_021824741.1 | 2e-17 | NAC domain-containing protein 35 isoform X1 | ||||
| Refseq | XP_021824742.1 | 3e-17 | NAC domain-containing protein 35 isoform X2 | ||||
| Refseq | XP_022942999.1 | 2e-17 | ferric reduction oxidase 7, chloroplastic-like | ||||
| Refseq | XP_023542912.1 | 2e-17 | ferric reduction oxidase 7, chloroplastic-like | ||||
| Swissprot | Q9ZVP8 | 3e-17 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
| TrEMBL | A0A075M5N5 | 9e-20 | A0A075M5N5_9SPER; NAC domain protein | ||||
| STRING | EMJ26777 | 7e-17 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02450.2 | 1e-19 | NAC domain containing protein 35 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




