PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00037046-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 154aa MW: 18032 Da PI: 8.6288

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00037046-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	141	6.8e-44	24	150	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrF Pt+eel+++yLkk+++g + +++ i+++d+y+++Pw+Lp +++ ek+w+fF++r++k+ r++r t sgyWkatg+d+++ PSME_00037046-RA 24 IPGFRFYPTEEELLSFYLKKRIQGGQQVNFDIiIPTLDMYRYDPWELPgLAIDVAEKQWFFFVPRETKKC--ARPTRLTVSGYWKATGSDRAI 114 69*******************9995555555***********77888999*****99875..7**************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ e +glkktLvfykg+ap g++tdW+m+eyr+ PSME_00037046-RA 115 RNELLECIGLKKTLVFYKGKAPLGQRTDWIMNEYRM 150 99999***************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.27E-42	16	151	IPR003441	NAC domain
PROSITE profile	PS51005	46.315	23	154	IPR003441	NAC domain
Pfam	PF02365	3.9E-24	25	150	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 154 aa Download sequence Send to blast
MRMAMAFLEE IYNDGAFKGE LPVIPGFRFY PTEEELLSFY LKKRIQGGQQ VNFDIIIPTL 60 DMYRYDPWEL PGLAIDVAEK QWFFFVPRET KKCARPTRLT VSGYWKATGS DRAIRNELLE 120 CIGLKKTLVF YKGKAPLGQR TDWIMNEYRM PDLA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-37	20	150	14	142	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-37	20	150	14	142	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-37	20	150	14	142	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-37	20	150	14	142	NO APICAL MERISTEM PROTEIN
4dul_A	3e-37	20	150	14	142	NAC domain-containing protein 19
4dul_B	3e-37	20	150	14	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT109581	1e-146	BT109581.1 Picea glauca clone GQ03210_D16 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004301581.1	2e-53	PREDICTED: NAC domain-containing protein 48
Refseq	XP_008339444.2	3e-53	NAC domain-containing protein 35
Refseq	XP_020598401.1	1e-53	NAC domain-containing protein 35-like, partial
Swissprot	Q9ZVP8	4e-51	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A075M5N5	2e-74	A0A075M5N5_9SPER; NAC domain protein
STRING	XP_008339444.1	1e-52	(Malus domestica)
STRING	XP_008352818.1	1e-52	(Malus domestica)
STRING	XP_004301581.1	8e-53	(Fragaria vesca)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	1e-53	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]