PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00039882-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 127aa MW: 14676.9 Da PI: 9.8665

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00039882-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	96.2	5e-30	21	94	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ e+yfFs+rdkky++g+ +nrat++gyWkat kd ++ s k++ +g+kktLvfy grap+g++tdWvmheyrl PSME_00039882-RA 21 RDLELYFFSPRDKKYPNGTCTNRATEAGYWKATWKDSKINS-KSSMIGTKKTLVFYGGRAPQGRRTDWVMHEYRL 94 45699**********************************.9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	30.381	1	114	IPR003441	NAC domain
SuperFamily	SSF101941	5.1E-31	19	99	IPR003441	NAC domain
Pfam	PF02365	1.5E-15	25	94	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MLQHLTQFLC LFVDKSFLPN RDLELYFFSP RDKKYPNGTC TNRATEAGYW KATWKDSKIN 60 SKSSMIGTKK TLVFYGGRAP QGRRTDWVMH EYRLDETQCE GAAGVQVPCL NWIKFSLSIK 120 KLENGVK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-27	2	96	46	144	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-27	2	96	46	144	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-27	2	96	46	144	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-27	2	96	46	144	NO APICAL MERISTEM PROTEIN
3swm_A	1e-27	2	96	49	147	NAC domain-containing protein 19
3swm_B	1e-27	2	96	49	147	NAC domain-containing protein 19
3swm_C	1e-27	2	96	49	147	NAC domain-containing protein 19
3swm_D	1e-27	2	96	49	147	NAC domain-containing protein 19
3swp_A	1e-27	2	96	49	147	NAC domain-containing protein 19
3swp_B	1e-27	2	96	49	147	NAC domain-containing protein 19
3swp_C	1e-27	2	96	49	147	NAC domain-containing protein 19
3swp_D	1e-27	2	96	49	147	NAC domain-containing protein 19
4dul_A	1e-27	2	96	46	144	NAC domain-containing protein 19
4dul_B	1e-27	2	96	46	144	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269\|PubMed:25081480}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028547959.1	4e-43	NAC domain-containing protein 45 isoform X1
Refseq	XP_028547960.1	4e-43	NAC domain-containing protein 45 isoform X2
Swissprot	A4VCM0	2e-37	NAC45_ARATH; NAC domain-containing protein 45
TrEMBL	A0A287PZ91	4e-43	A0A287PZ91_HORVV; Uncharacterized protein
STRING	PGSC0003DMT400018364	9e-44	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65910.1	1e-43	NAC domain containing protein 28

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]