![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00040693-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 48aa MW: 5716.4 Da PI: 4.4015 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.3 | 1e-09 | 2 | 40 | 3 | 43 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
++++E++l+ ++ ++lG + W++Ia +++ gRt ++ +
PSME_00040693-RA 2 DFSEDEEDLISRLYNLLGQR-WDLIAGRIP-GRTVDEIEKY 40
59*****************9.*********.***9998766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.278 | 1 | 48 | IPR017930 | Myb domain |
| Pfam | PF00249 | 7.0E-9 | 2 | 40 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-11 | 3 | 40 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.95E-7 | 3 | 41 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.50E-6 | 3 | 41 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 48 aa Download sequence Send to blast |
MDFSEDEEDL ISRLYNLLGQ RWDLIAGRIP GRTVDEIEKY CSKRYASY |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF082122 | 1e-59 | EF082122.1 Picea sitchensis clone WS02813_H08 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009417220.1 | 5e-20 | PREDICTED: MYB-like transcription factor ETC1 isoform X1 | ||||
| Refseq | XP_009417221.1 | 5e-20 | PREDICTED: MYB-like transcription factor ETC1 isoform X2 | ||||
| TrEMBL | A9NLI8 | 5e-24 | A9NLI8_PICSI; Uncharacterized protein | ||||
| STRING | XP_009604372.1 | 3e-18 | (Nicotiana tomentosiformis) | ||||
| STRING | GSMUA_Achr10P09220_001 | 2e-18 | (Musa acuminata) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46410.1 | 5e-17 | MYB_related family protein | ||||




