![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00041020-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 90aa MW: 9866.69 Da PI: 10.4776 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 124.8 | 2.7e-39 | 26 | 90 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ +G+nPGlivllvv g+ll f+vgny+ly+yaqk+lPP+kkkPvskkk+kreklkqG+++PGe
PSME_00041020-RA 26 AAGRGFNPGLIVLLVVVGVLLAFIVGNYVLYMYAQKTLPPKKKKPVSKKKMKREKLKQGISAPGE 90
4569************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 0.003 | 22 | 90 | No hit | No description |
| Pfam | PF04689 | 2.9E-38 | 27 | 90 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MEEDFSSQAD VDPSTFAGQE RLLTKAAGRG FNPGLIVLLV VVGVLLAFIV GNYVLYMYAQ 60 KTLPPKKKKP VSKKKMKREK LKQGISAPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT118304 | 1e-118 | BT118304.1 Picea glauca clone GQ04004_N22 mRNA sequence. | |||
| GenBank | EF084567 | 1e-118 | EF084567.1 Picea sitchensis clone WS02720_J04 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 7e-26 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 7e-26 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 2e-14 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | W9SCA3 | 8e-24 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 1e-24 | (Morus notabilis) | ||||




