![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00048117-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 122aa MW: 14089.1 Da PI: 4.5433 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 145.5 | 1.2e-45 | 2 | 89 | 15 | 102 |
NF-YC 15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
+fk+h+lPl rikki+k+dedvkmisaea vl+skace+fileltlrswlh+eenkrrtl+++dia a++r d+ dfl+divprde+k
PSME_00048117-RA 2 EFKHHQLPLVRIKKIMKSDEDVKMISAEALVLFSKACEIFILELTLRSWLHTEENKRRTLQRNDIAGAISRGDVLDFLLDIVPRDEVK 89
79***********************************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 5.37E-27 | 2 | 100 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.0E-19 | 7 | 70 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-34 | 8 | 85 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MEFKHHQLPL VRIKKIMKSD EDVKMISAEA LVLFSKACEI FILELTLRSW LHTEENKRRT 60 LQRNDIAGAI SRGDVLDFLL DIVPRDEVKE EDNGCTDYLP DTPDGFVEEP RIPEKDSPPV 120 EL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 7e-44 | 2 | 85 | 12 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 57 | 63 | RRTLQRN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF085083 | 1e-112 | EF085083.1 Picea sitchensis clone WS0296_J03 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024369382.1 | 1e-52 | nuclear transcription factor Y subunit C-2-like | ||||
| Swissprot | Q8LCG7 | 1e-48 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q9FMV5 | 4e-48 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
| TrEMBL | A9NUT0 | 1e-53 | A9NUT0_PICSI; Uncharacterized protein | ||||
| STRING | PP1S315_9V6.3 | 5e-52 | (Physcomitrella patens) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 6e-51 | nuclear factor Y, subunit C2 | ||||




