![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00049981-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 65aa MW: 7307.69 Da PI: 9.0346 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 65 | 1.8e-20 | 15 | 61 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
+CaaCk++r+kC+++Cvlapyfp+++++kf vh++FG +v+kll+
PSME_00049981-RA 15 PCAACKMQRKKCTDKCVLAPYFPQAEREKFLLVHRVFGHGHVIKLLQ 61
7*******************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 16.011 | 14 | 65 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 2.9E-19 | 15 | 61 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 65 aa Download sequence Send to blast |
MGETAMNSEG LSTSPCAACK MQRKKCTDKC VLAPYFPQAE REKFLLVHRV FGHGHVIKLL 60 QVQMI |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022964985.1 | 1e-17 | LOB domain-containing protein 11-like isoform X2 | ||||
| Refseq | XP_022970429.1 | 1e-17 | LOB domain-containing protein 1-like isoform X2 | ||||
| Swissprot | Q9SK08 | 2e-17 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
| TrEMBL | B8LQI9 | 2e-21 | B8LQI9_PICSI; Uncharacterized protein | ||||
| STRING | Gorai.012G185900.1 | 4e-17 | (Gossypium raimondii) | ||||
| STRING | OMERI05G01710.1 | 4e-17 | (Oryza meridionalis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28500.1 | 8e-20 | LOB domain-containing protein 11 | ||||




