PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00050198-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

LBD

Protein Properties

Length: 118aa MW: 12410.4 Da PI: 6.6675

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00050198-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	82.1	8.3e-26	25	99	27	101
DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 + +f +vhk+FGasnv+kll +lp +r +a+ ++ yeA+ar++dP+yG+v++i++lqqql++l+aela ++++l PSME_00050198-RA 25 ATHFTAVHKIFGASNVSKLLLHLPMPDRCEAVVTISYEAQARLQDPIYGCVAHIFALQQQLASLQAELAFVQAQL 99 579*******************************************************************99985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	12.913	1	99	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.6E-23	24	96	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
MQVVAALGEI ILGVVVAAET LMTGATHFTA VHKIFGASNV SKLLLHLPMP DRCEAVVTIS 60 YEAQARLQDP IYGCVAHIFA LQQQLASLQA ELAFVQAQLA SRVSSGSASI SANHPVIS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	1e-19	9	118	21	130	LOB family transfactor Ramosa2.1
5ly0_B	1e-19	9	118	21	130	LOB family transfactor Ramosa2.1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in lateral root formation. Regulated by the transcriptional activators ARF7 and ARF19. {ECO:0000269\|PubMed:17259263}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:15659631, ECO:0000269\|PubMed:17259263}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021814837.1	1e-40	LOB domain-containing protein 29-like
Swissprot	Q9M2J7	1e-36	LBD29_ARATH; LOB domain-containing protein 29
TrEMBL	D5A9D3	7e-47	D5A9D3_PICSI; Uncharacterized protein
STRING	cassava4.1_026776m	9e-39	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58190.1	9e-31	lateral organ boundaries-domain 29

Publications ? help Back to Top
Gupta A,Singh M,Laxmi A Interaction between glucose and brassinosteroid during the regulation of lateral root development in Arabidopsis. Plant Physiol., 2015. 168(1): p. 307-20 [PMID:25810094] Porco S, et al. Lateral root emergence in Arabidopsis is dependent on transcription factor LBD29 regulation of auxin influx carrier LAX3. Development, 2016. 143(18): p. 3340-9 [PMID:27578783] Lee K,Seo PJ High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis. Planta, 2017. 246(4): p. 797-802 [PMID:28766014] Xu C,Cao H,Xu E,Zhang S,Hu Y Genome-Wide Identification of Arabidopsis LBD29 Target Genes Reveals the Molecular Events behind Auxin-Induced Cell Reprogramming during Callus Formation. Plant Cell Physiol., 2018. 59(4): p. 744-755 [PMID:29121271] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751]