![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PSME_00050587-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 117aa MW: 13329.1 Da PI: 10.8337 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 95.8 | 6.4e-30 | 5 | 76 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+e+ewyfFs+rd+ky++ r+nra++sgyWkatg+dk++l+ ++ g+kk Lvfy gr pkg kt+W+mheyrl
PSME_00050587-RA 5 GEQEWYFFSPRDRKYPNRARSNRAATSGYWKATGTDKPILT---STSGVKKALVFYGGRPPKGIKTNWIMHEYRL 76
689*************************************9...678**************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 39.095 | 1 | 106 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 5.75E-36 | 3 | 107 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.4E-15 | 8 | 76 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
KATFGEQEWY FFSPRDRKYP NRARSNRAAT SGYWKATGTD KPILTSTSGV KKALVFYGGR 60 PPKGIKTNWI MHEYRLADSG ARPSSFPNNK GSLRLDDWVL CRIYKKNGHS QRVQGAE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-45 | 1 | 112 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-45 | 1 | 112 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-45 | 1 | 112 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-45 | 1 | 112 | 65 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 1e-45 | 1 | 112 | 68 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 1e-45 | 1 | 112 | 65 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 1e-45 | 1 | 112 | 65 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015888238.2 | 2e-59 | NAC transcription factor 25-like, partial | ||||
| Refseq | XP_021902077.1 | 9e-59 | NAC transcription factor 25 | ||||
| Swissprot | Q8GY42 | 6e-54 | NAC25_ARATH; NAC transcription factor 25 | ||||
| TrEMBL | A0A482ERL1 | 3e-58 | A0A482ERL1_9SPER; NAC3 domain protein | ||||
| STRING | evm.model.supercontig_27.81 | 4e-58 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 3e-56 | NAC domain containing protein 25 | ||||




