PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00053960-RA
Organism
Pseudotsuga menziesii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family NAC
Protein Properties Length: 107aa    MW: 12655.4 Da    PI: 6.9415
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00053960-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM89.55.9e-2828107282
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                       ppGfrF Ptdeelvv+yL+kk++++ +++  +i ev++yk++Pw+Lp k   +ekewyfF++rd+ky++g+r++r++ sgy
  PSME_00053960-RA  28 PPGFRFFPTDEELVVHYLCKKATSQIIPV-PIIVEVGLYKYDPWQLPDKSLFGEKEWYFFTTRDRKYPNGSRTKRVAGSGY 107
                       9****************************.88***************7777799**********************99998 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-3321107IPR003441NAC domain
PROSITE profilePS5100531.17327107IPR003441NAC domain
PfamPF023653.5E-1228106IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MGTSLGEFHE EQPWILKNMD CHEHNQWPPG FRFFPTDEEL VVHYLCKKAT SQIIPVPIIV  60
EVGLYKYDPW QLPDKSLFGE KEWYFFTTRD RKYPNGSRTK RVAGSGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-4015107395Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931441.19e-42NAC domain-containing protein 68 isoform X1
SwissprotQ52QH41e-39NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A0D6R3P97e-44A0A0D6R3P9_ARACU; Uncharacterized protein
STRINGVIT_06s0004g00020.t018e-41(Vitis vinifera)
STRINGGSMUA_Achr6P32330_0017e-41(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-41NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]