PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00054178-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 115aa MW: 13377.5 Da PI: 9.0431

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00054178-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	87	3.5e-27	36	113	2	80
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratks 80 ppGf F Ptdeelvv+yL+kk++++ +++ +i+evd+yk++Pw+Lp k+ +ekewyfF++rd+ky++g+r++rat s PSME_00054178-RA 36 PPGFIFFPTDEELVVHYLCKKAASQIIPV-PIIAEVDLYKYDPWQLPDKALFGEKEWYFFTPRDRKYPNGSRPKRATGS 113 9**************************.88***********8777899*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-31	29	113	IPR003441	NAC domain
PROSITE profile	PS51005	30.687	35	115	IPR003441	NAC domain
Pfam	PF02365	9.0E-11	36	110	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MGGIKGLGTI RVAIHLEELC KQARDHYALL LHNQWPPGFI FFPTDEELVV HYLCKKAASQ 60 IIPVPIIAEV DLYKYDPWQL PDKALFGEKE WYFFTPRDRK YPNGSRPKRA TGSRY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	7e-42	36	115	16	95	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in stress response. {ECO:0000250\|UniProtKB:Q7F2L3}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:20632034}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010257746.1	3e-43	PREDICTED: NAC domain-containing protein 68-like
Swissprot	Q52QH4	1e-41	NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBL	A0A0D6R3P9	5e-46	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_010257746.1	1e-42	(Nelumbo nucifera)
STRING	GSMUA_Achr6P32330_001	4e-43	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-43	NAC family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Taga Y, et al. Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] Xia N, et al. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411]