PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00054708-RA

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

WRKY

Protein Properties

Length: 126aa MW: 14605.5 Da PI: 10.1959

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00054708-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	86.2	3e-27	28	85	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKY +K vk+s++pr+Y+rC+ ++C vkk ver+a+d+ +v++ Y g+Hnhe PSME_00054708-RA 28 EDGYKWRKYRKKFVKNSPNPRNYFRCSDNNCGVKKTVERDARDKGIVITSYLGKHNHE 85 8********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.6E-29	14	87	IPR003657	WRKY domain
SuperFamily	SSF118290	6.02E-25	19	87	IPR003657	WRKY domain
PROSITE profile	PS50811	27.841	22	87	IPR003657	WRKY domain
SMART	SM00774	3.6E-27	27	86	IPR003657	WRKY domain
Pfam	PF03106	3.3E-21	28	85	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
SPNKSRKRKA ERGAKYAFLT RSDTDILEDG YKWRKYRKKF VKNSPNPRNY FRCSDNNCGV 60 KKTVERDARD KGIVITSYLG KHNHESPSVI YYTLDPEILV QLPRQTTGSP IFSSMNYVPG 120 CSEQHQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	8e-23	20	88	10	78	Probable WRKY transcription factor 4
2lex_A	8e-23	20	88	10	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006842164.1	5e-36	probable WRKY transcription factor 50
Swissprot	Q93WU9	1e-27	WRK51_ARATH; Probable WRKY transcription factor 51
Swissprot	Q93WV4	4e-27	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	A0A0D6R4C9	6e-45	A0A0D6R4C9_ARACU; Uncharacterized protein
STRING	ERN03839	2e-35	(Amborella trichopoda)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	5e-30	WRKY DNA-binding protein 51

Publications ? help Back to Top
Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465] Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]