PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PSME_00054766-RA

Common Name

C3HDZ2

Organism

Pseudotsuga menziesii

Taxonomic ID

3357

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

HB-other

Protein Properties

Length: 122aa MW: 14592.9 Da PI: 10.1098

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00054766-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	51.9	1.3e-16	17	75	3	57
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 k ++t+eq+e+Le+l++ +++p +r++ +++ +++ +q+kvWFqNrR +ek+ PSME_00054766-RA 17 KYVRYTAEQVEALERLYNDCPKPISLRRQQHIRECpilsHIEPKQIKVWFQNRRCREKQ 75 5678*****************************************************97 PP
2	bZIP_1	23.6	1.1e-07	69	112	18	61
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 rr+R++ +e +L++ +L+a Nk L +e+++l+k+v++l PSME_00054766-RA 69 RRCREKQHKEASRLQTVNMKLTAMNKLLMEENDRLQKQVSQLVY 112 9***************************************9965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	13.378	12	76	IPR001356	Homeobox domain
SMART	SM00389	3.1E-9	14	80	IPR001356	Homeobox domain
CDD	cd00086	3.97E-9	17	77	No hit	No description
SuperFamily	SSF46689	3.29E-13	17	79	IPR009057	Homeodomain-like
Pfam	PF00046	7.8E-14	18	75	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	4.5E-16	19	72	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.20.5.170	3.4E-4	73	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MTVTVVTAQS RAMEAGKYVR YTAEQVEALE RLYNDCPKPI SLRRQQHIRE CPILSHIEPK 60 QIKVWFQNRR CREKQHKEAS RLQTVNMKLT AMNKLLMEEN DRLQKQVSQL VYENGYFRQQ 120 IQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of vascular development. May promote differentiation of precambial and cambial cells. {ECO:0000269\|PubMed:11402194, ECO:0000269\|PubMed:15598805}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. Repressed by miR165. {ECO:0000269\|PubMed:17237362, ECO:0000269\|PubMed:8575317}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ385529	0.0	DQ385529.1 Pseudotsuga menziesii class III homeodomain-leucine zipper protein C3HDZ2 (C3HDZ2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009378434.1	2e-66	PREDICTED: homeobox-leucine zipper protein ATHB-15-like, partial
Swissprot	Q39123	4e-62	ATHB8_ARATH; Homeobox-leucine zipper protein ATHB-8
TrEMBL	Q20BK6	1e-73	Q20BK6_PSEMZ; Class III homeodomain-leucine zipper protein C3HDZ2
STRING	XP_009378434.1	7e-66	(Pyrus x bretschneideri)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G32880.1	2e-64	homeobox gene 8

Publications ? help Back to Top
Floyd SK,Zalewski CS,Bowman JL Evolution of class III homeodomain-leucine zipper genes in streptophytes. Genetics, 2006. 173(1): p. 373-88 [PMID:16489224] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Hategan L,Godza B,Kozma-Bognar L,Bishop GJ,Szekeres M Differential expression of the brassinosteroid receptor-encoding BRI1 gene in Arabidopsis. Planta, 2014. 239(5): p. 989-1001 [PMID:24488524] Baima S, et al. Negative feedback regulation of auxin signaling by ATHB8/ACL5-BUD2 transcription module. Mol Plant, 2014. 7(6): p. 1006-1025 [PMID:24777988] Kakehi J, et al. Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana. PLoS ONE, 2015. 10(1): p. e0117309 [PMID:25625317] Jia X, et al. Functional plasticity of miR165/166 in plant development revealed by small tandem target mimic. Plant Sci., 2015. 233: p. 11-21 [PMID:25711809] Liu S, et al. Expression of wild-type PtrIAA14.1, a poplar Aux/IAA gene causes morphological changes in Arabidopsis. Front Plant Sci, 2015. 6: p. 388 [PMID:26082787] Yamaguchi YL, et al. Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots. Front Plant Sci, 2017. 8: p. 1195 [PMID:28747918] Yamazaki K, et al. Suppression of DELLA signaling induces procambial cell formation in culture. Plant J., 2018. 94(1): p. 48-59 [PMID:29383774]