| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 162.5 | 1.5e-50 | 36 | 162 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
ppGf+F Pt eelvv+yL+kk +++ +++ +i+evd+yk++Pw+Lp k++ +ekewyfF+++d+ky++g+r++rat sgyWkatg dk++ +
PSME_00055048-RA 36 PPGFKFFPTYEELVVHYLCKKEASQIIPV-PIIAEVDLYKYDPWQLPDKAQFGEKEWYFFTPHDRKYPNGSRPKRATGSGYWKATGVDKPINV 127
9****************************.88***************99999***************************************** PP
NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
k +++ vg+kk Lvfy g+apkg+kt+W+mheyrl
PSME_00055048-RA 128 KgGKKRVGIKKALVFYVGKAPKGSKTNWIMHEYRL 162
966777***************************98 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 2e-67 | 23 | 178 | 5 | 155 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-67 | 23 | 178 | 5 | 155 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-67 | 23 | 178 | 5 | 155 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-67 | 23 | 178 | 5 | 155 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swm_B | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swm_C | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swm_D | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swp_A | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swp_B | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swp_C | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 3swp_D | 2e-67 | 23 | 178 | 8 | 158 | NAC domain-containing protein 19 |
| 4dul_A | 2e-67 | 23 | 178 | 5 | 155 | NAC domain-containing protein 19 |
| 4dul_B | 2e-67 | 23 | 178 | 5 | 155 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Taga Y, et al.
Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] - Xia N, et al.
Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] - Takasaki H, et al.
The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] - Nakayama A, et al.
Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] - Takasaki H, et al.
SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] - Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411] - Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ
ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] - Allu AD,Brotman Y,Xue GP,Balazadeh S
Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] - Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ
The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] - Song L, et al.
A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]
|