![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pahal.B01216.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 73aa MW: 8380.96 Da PI: 11.5856 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 52.9 | 5.1e-17 | 15 | 49 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C++t T+lWR+gp g k+LCn CGl+yr+kgl
Pahal.B01216.1 15 CTQCHATITSLWRSGPFGRKSLCNVCGLRYRRKGL 49
********************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 1.43E-11 | 8 | 49 | No hit | No description |
| PROSITE profile | PS50114 | 12.374 | 9 | 64 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 1.4E-9 | 9 | 61 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.2E-13 | 14 | 49 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 8.70E-9 | 15 | 65 | No hit | No description |
| Pfam | PF00320 | 7.5E-15 | 15 | 49 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MKVVCSLNRN KLKMCTQCHA TITSLWRSGP FGRKSLCNVC GLRYRRKGLE GQELGRKKDR 60 GKNRRYINRV PL* |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015646409.1 | 2e-17 | GATA transcription factor 15 | ||||
| TrEMBL | A2YJW2 | 4e-16 | A2YJW2_ORYSI; Uncharacterized protein | ||||
| STRING | Pavir.Ba03329.1.p | 2e-30 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP18253 | 8 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56860.1 | 4e-12 | GATA family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pahal.B01216.1 |




