![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pahal.B02775.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 90aa MW: 9882.21 Da PI: 8.2099 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 96.9 | 1.5e-30 | 18 | 76 | 1 | 60 |
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+++vrY eC++NhAas+Gg+a+DGC+Ef+++ g egt aalkCaACgCHR+FHRr +++e
Pahal.B02775.1 18 CCSVRYGECRRNHAASTGGYAIDGCREFIAE-GVEGTGAALKCAACGCHRSFHRRVQVYE 76
5789**************************8.999********************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 4.0E-25 | 1 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 2.4E-29 | 21 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 8.7E-23 | 22 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 24.396 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MKRLLIVRRC EPIVRFSCCS VRYGECRRNH AASTGGYAID GCREFIAEGV EGTGAALKCA 60 ACGCHRSFHR RVQVYEVAWD YGSDTSSTE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025799866.1 | 2e-59 | mini zinc finger protein 3-like | ||||
| Swissprot | Q6ER22 | 1e-32 | MIF3_ORYSJ; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A2S3GZH5 | 4e-58 | A0A2S3GZH5_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7ESA1 | 4e-58 | A0A2T7ESA1_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Bb02187.1.p | 7e-57 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74660.1 | 2e-26 | mini zinc finger 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pahal.B02775.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




