PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pahal.C01462.1

Organism

Panicum hallii

Taxonomic ID

206008

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

MYB_related

Protein Properties

Length: 121aa MW: 13150.3 Da PI: 12.2635

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pahal.C01462.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	38	3.9e-12	29	72	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 W ++E+ ++++a ++G + Wk +a+ +g ++t+ q++s+ qk+ Pahal.C01462.1 29 EMWAADEHGRFLHALLLFGRD-WKPVAQFVG-TKTATQVRSHAQKH 72 67***************77.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	4.93E-15	23	78	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.441	23	77	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-6	26	78	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	6.6E-13	27	75	IPR006447	Myb domain, plants
SMART	SM00717	1.4E-4	27	75	IPR001005	SANT/Myb domain
Pfam	PF00249	5.9E-10	29	72	IPR001005	SANT/Myb domain
CDD	cd00167	3.34E-6	31	73	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MKLAMAAARN NSSAGKKPRK PYKITRPREM WAADEHGRFL HALLLFGRDW KPVAQFVGTK 60 TATQVRSHAQ KHFLKAQKLG LGAALPPPKP RRGAVLAAHS PSSVRHDDNA VAPGGGRRKF 120 *

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025808779.1	8e-61	protein REVEILLE 6-like
Swissprot	Q8RWU3	7e-29	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	A0A2T7E8M5	5e-74	A0A2T7E8M5_9POAL; Uncharacterized protein
STRING	Pavir.J12412.1.p	3e-43	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3642	31	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.1	2e-22	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Pahal.C01462.1

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]