![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pahal.C01870.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 141aa MW: 15386.2 Da PI: 4.908 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.7 | 2e-54 | 18 | 114 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
+eqdr+lPian++rim++++P+n+ki+kdake+vqecvsefisf+tseasdkc +ekrktingddl+w+++tlGfe+yveplk ylk yre+eg+
Pahal.C01870.4 18 KEQDRYLPIANIGRIMRRAVPENGKIAKDAKESVQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSMGTLGFEEYVEPLKHYLKLYRETEGD 112
89********************************************************************************************9 PP
NF-YB 97 kk 98
+k
Pahal.C01870.4 113 TK 114
75 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-50 | 16 | 123 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.19E-38 | 20 | 120 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-26 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-19 | 51 | 69 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-19 | 70 | 88 | No hit | No description |
| PRINTS | PR00615 | 2.3E-19 | 89 | 107 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MSEAEGAPET GGGSYGGKEQ DRYLPIANIG RIMRRAVPEN GKIAKDAKES VQECVSEFIS 60 FITSEASDKC MKEKRKTING DDLIWSMGTL GFEEYVEPLK HYLKLYRETE GDTKGSKSSD 120 HTGKKEILLN GEPGSSFDGV * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 3e-46 | 18 | 108 | 3 | 93 | NF-YB |
| 4awl_B | 3e-46 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-46 | 18 | 108 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP101633 | 1e-129 | FP101633.1 Phyllostachys edulis cDNA clone: bphyst004h13, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025805143.1 | 2e-99 | nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_025805144.1 | 2e-99 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | Q65XK1 | 2e-75 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2T7EA31 | 8e-98 | A0A2T7EA31_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T8KII4 | 8e-98 | A0A2T8KII4_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T8KIK1 | 2e-97 | A0A2T8KIK1_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.J31885.1.p | 2e-94 | (Panicum virgatum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 7e-60 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pahal.C01870.4 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




