PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E03955.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8961.58 Da    PI: 11.477
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E03955.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF762.8e-241360451
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ++   rqv f kRr+g++KKA+ELS LCdaev +++fs+ gklyeyss
  Pahal.E03955.2 13 QDRLSRQVRFFKRRTGLFKKAFELSLLCDAEVVLLVFSPAGKLYEYSS 60
                    67889*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-27261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.717262IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-25424IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-24462IPR002100Transcription factor, MADS-box
PfamPF003195.9E-221458IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-252439IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-253960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MAPRGRVQLR RFQDRLSRQV RFFKRRTGLF KKAFELSLLC DAEVVLLVFS PAGKLYEYSS  60
SASFILALDC ARQMKRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A5e-16461259Myocyte-specific enhancer factor 2A
3kov_B5e-16461259Myocyte-specific enhancer factor 2A
3kov_I5e-16461259Myocyte-specific enhancer factor 2A
3kov_J5e-16461259Myocyte-specific enhancer factor 2A
3mu6_A4e-16461259Myocyte-specific enhancer factor 2A
3mu6_B4e-16461259Myocyte-specific enhancer factor 2A
3mu6_C4e-16461259Myocyte-specific enhancer factor 2A
3mu6_D4e-16461259Myocyte-specific enhancer factor 2A
3p57_A5e-16461259Myocyte-specific enhancer factor 2A
3p57_B5e-16461259Myocyte-specific enhancer factor 2A
3p57_C5e-16461259Myocyte-specific enhancer factor 2A
3p57_D5e-16461259Myocyte-specific enhancer factor 2A
3p57_I5e-16461259Myocyte-specific enhancer factor 2A
3p57_J5e-16461259Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848191e-60KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817633.12e-39MADS-box transcription factor 51-like
SwissprotQ9XJ611e-29MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBLA0A2T8INP96e-47A0A2T8INP9_9POAL; Uncharacterized protein
STRINGGRMZM2G171650_P053e-30(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.11e-25AGAMOUS-like 79
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]