PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pahal.E03955.2

Organism

Panicum hallii

Taxonomic ID

206008

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 8961.58 Da PI: 11.477

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pahal.E03955.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	76	2.8e-24	13	60	4	51
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ++ rqv f kRr+g++KKA+ELS LCdaev +++fs+ gklyeyss Pahal.E03955.2 13 QDRLSRQVRFFKRRTGLFKKAFELSLLCDAEVVLLVFSPAGKLYEYSS 60 67889*****************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-27	2	61	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.717	2	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	4	24	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.14E-24	4	62	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.9E-22	14	58	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	24	39	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-25	39	60	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MAPRGRVQLR RFQDRLSRQV RFFKRRTGLF KKAFELSLLC DAEVVLLVFS PAGKLYEYSS 60 SASFILALDC ARQMKRS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_B	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_I	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3kov_J	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_A	4e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_B	4e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_C	4e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3mu6_D	4e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_A	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_B	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_C	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_D	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_I	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
3p57_J	5e-16	4	61	2	59	Myocyte-specific enhancer factor 2A
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF184819	1e-60	KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025817633.1	2e-39	MADS-box transcription factor 51-like
Swissprot	Q9XJ61	1e-29	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A2T8INP9	6e-47	A0A2T8INP9_9POAL; Uncharacterized protein
STRING	GRMZM2G171650_P05	3e-30	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30260.1	1e-25	AGAMOUS-like 79

Link Out ? help Back to Top
Phytozome	Pahal.E03955.2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]