![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pahal.I03829.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 95aa MW: 10312.7 Da PI: 9.4376 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 20.6 | 8e-07 | 22 | 61 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
+i + ++L+ llP+a ++ ++ a +L++++ YI+sL
Pahal.I03829.1 22 QISDLVAKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 61
789999*********8899*******************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.737 | 7 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 1.44E-8 | 21 | 83 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 2.6E-7 | 21 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MSSRRSRSRA SSGGASRISD EQISDLVAKL QALLPEARLR SNDRVPSARV LQETCSYIRS 60 LHREVDDLSD RLSELLATAD VSTAQAAVIR SLLM* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP093869 | 6e-97 | FP093869.1 Phyllostachys edulis cDNA clone: bphyst028g12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004983143.1 | 5e-58 | transcription factor ILI7 | ||||
| Refseq | XP_025797606.1 | 5e-58 | transcription factor ILI7 | ||||
| Swissprot | A2Z730 | 1e-43 | ILI7_ORYSI; Transcription factor ILI7 | ||||
| Swissprot | Q338G6 | 1e-43 | ILI7_ORYSJ; Transcription factor ILI7 | ||||
| TrEMBL | A0A2S3IMI6 | 1e-56 | A0A2S3IMI6_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7C6W6 | 1e-56 | A0A2T7C6W6_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A3L6SFA9 | 1e-56 | A0A3L6SFA9_PANMI; Transcription factor ILI7 | ||||
| TrEMBL | K4AH62 | 1e-56 | K4AH62_SETIT; Uncharacterized protein | ||||
| STRING | Si038219m | 2e-57 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2675 | 33 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 4e-33 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pahal.I03829.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




