![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.1NG467300.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 120aa MW: 12508.5 Da PI: 11.0954 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 67.4 | 2.7e-21 | 62 | 118 | 7 | 63 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktin 63
lP+an++r+m++v+P+ k+s ak+++++c +ef++fv++eas+k+q+++r+ i+
Pavir.1NG467300.1.p 62 GLPMANLVRLMRQVIPKGVKVSARAKHLTHDCTVEFVGFVAGEASEKAQAQHRRIIS 118
69****************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.2E-14 | 60 | 119 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-12 | 62 | 119 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 3.39E-12 | 63 | 119 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MDKALSSAVT TKLRKIERMG RKAKRGGAKK GVRDTEKTKV APADDCASPG GEGGSTASAA 60 AGLPMANLVR LMRQVIPKGV KVSARAKHLT HDCTVEFVGF VAGEASEKAQ AQHRRIISP* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing kernels. {ECO:0000269|PubMed:11971906}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May act through association with MADS-box proteins. May regulate the expression of genes involved in flowering. {ECO:0000269|PubMed:11971906}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.1NG467300.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC243257 | 1e-101 | AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025822765.1 | 5e-62 | nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q6Z348 | 4e-22 | NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A2T8KXK0 | 1e-60 | A0A2T8KXK0_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Aa00694.1.p | 3e-67 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13659 | 26 | 31 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 6e-14 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.1NG467300.1.p |




