![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.2NG111800.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 95aa MW: 10949.8 Da PI: 10.4249 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 51.8 | 1.1e-16 | 39 | 73 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C+tt T+lW +gp g k+LCnaCGl+yr+kgl
Pavir.2NG111800.1.p 39 CTQCHTTVTSLWLNGPFGRKSLCNACGLRYRRKGL 73
********************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 2.52E-12 | 31 | 73 | No hit | No description |
| SMART | SM00401 | 2.6E-12 | 33 | 85 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.347 | 33 | 90 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.5E-13 | 37 | 73 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.82E-10 | 38 | 72 | No hit | No description |
| Pfam | PF00320 | 8.0E-15 | 39 | 73 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MCTKEKAVVS AILYSYSWQP IPLCQKVVRS LERNKSKICT QCHTTVTSLW LNGPFGRKSL 60 CNACGLRYRR KGLEAQELER EEDKGKNKRR INRF* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.2NG111800.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015646409.1 | 9e-19 | GATA transcription factor 15 | ||||
| TrEMBL | A2YJW2 | 2e-17 | A2YJW2_ORYSI; Uncharacterized protein | ||||
| STRING | Pavir.Ba03329.1.p | 6e-64 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP18253 | 8 | 10 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49300.1 | 4e-11 | GATA transcription factor 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.2NG111800.1.p |




