![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.3KG168200.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 130aa MW: 14134.1 Da PI: 10.2908 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60 | 3.1e-19 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C+tt Tp+WR gp g+++LCnaCG++yrkk++
Pavir.3KG168200.1.p 21 CVECRTTATPMWRGGPTGPRSLCNACGIRYRKKRR 55
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 1.2E-14 | 15 | 72 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.09E-13 | 16 | 56 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 7.3E-15 | 20 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 8.28E-12 | 21 | 56 | No hit | No description |
| Pfam | PF00320 | 4.3E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.176 | 21 | 51 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 130 aa Download sequence Send to blast |
MMDAAEHNVI GIAAEPGRPC CVECRTTATP MWRGGPTGPR SLCNACGIRY RKKRRQELGL 60 DNNRKPQQNQ QPPQQPQHQD HSHAPSAVSD NKSSGLQVVK KRRVLMGVEE AAILLMALSS 120 SSRSTLLHG* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.31949 | 0.0 | leaf| root | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.3KG168200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728012 | 7e-82 | KJ728012.1 Zea mays clone pUT6147 C2C2-GATA transcription factor (GATA12) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025807325.1 | 5e-60 | GATA transcription factor 23-like | ||||
| TrEMBL | A0A3L6REC3 | 5e-61 | A0A3L6REC3_PANMI; GATA transcription factor 23-like | ||||
| STRING | Pavir.J34225.1.p | 7e-58 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 9e-21 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.3KG168200.1.p |




