PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pavir.4NG328100.3.p

Organism

Panicum virgatum

Taxonomic ID

38727

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

bZIP

Protein Properties

Length: 153aa MW: 16965.2 Da PI: 8.7263

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.4NG328100.3.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	55.4	1.3e-17	80	136	3	59
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 +++r +r+++NRe+A rsR+RK+a++e+Le++v L eN +Lkk+ +elk eva+l Pavir.4NG328100.3.p 80 DDRRSIRMMRNRESALRSRARKRAYVENLEKEVRRLVDENLKLKKQCKELKLEVAAL 136 5799************************************************99987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.9E-14	78	142	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.6E-16	79	136	No hit	No description
PROSITE profile	PS50217	11.53	80	136	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.0E-14	81	136	IPR004827	Basic-leucine zipper domain
CDD	cd14707	1.90E-18	82	136	No hit	No description
SuperFamily	SSF57959	1.63E-12	82	136	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MAANYHHYQM AAAWREPDSP QLSFMSGCSS LFSISTLQDD DDGAFVIAGH ALPSTPVSLA 60 GFAGDEVDME VQQISGGSGD DRRSIRMMRN RESALRSRAR KRAYVENLEK EVRRLVDENL 120 KLKKQCKELK LEVAALVLPT KSSLRRTSST QF*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pvr.19626	0.0	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in shoot apex. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980, ECO:0000269\|PubMed:25661797}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.4NG328100.3.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT033858	1e-122	BT033858.1 Zea mays full-length cDNA clone ZM_BFc0165B20 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025812603.1	1e-105	bZIP transcription factor 46-like
Swissprot	Q84JK2	1e-14	FD_ARATH; Protein FD
TrEMBL	A0A2S3HG73	1e-103	A0A2S3HG73_9POAL; Uncharacterized protein
TrEMBL	A0A2T7DU08	1e-103	A0A2T7DU08_9POAL; Uncharacterized protein
TrEMBL	A0A3L6PES2	1e-103	A0A3L6PES2_PANMI; Protein FD-like
STRING	Si007412m	1e-102	(Setaria italica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	3e-10	bZIP family protein

Link Out ? help Back to Top
Phytozome	Pavir.4NG328100.3.p

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]