![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.5NG348800.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 128aa MW: 13824.6 Da PI: 10.2842 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.8 | 8.1e-20 | 22 | 56 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C++t+Tp+WR+gp g+++LCnaCG++yrkk++
Pavir.5NG348800.1.p 22 CVECRATTTPMWRSGPTGPRSLCNACGIRYRKKRR 56
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 1.2E-13 | 16 | 74 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 13.138 | 16 | 52 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.99E-13 | 19 | 57 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 9.7E-16 | 21 | 57 | IPR013088 | Zinc finger, NHR/GATA-type |
| Pfam | PF00320 | 1.5E-17 | 22 | 56 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 22 | 47 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 6.04E-13 | 22 | 57 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MGSADRSEID GIAVAERGAR GCVECRATTT PMWRSGPTGP RSLCNACGIR YRKKRRQELG 60 LDHKQQQQLR QQHNGEVKTE VKDSSSSSSG SSNLQAVQKR RLLMGVEEAA LLLMTLSSSP 120 TSTLLHG* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.2794 | 1e-174 | callus| root | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.5NG348800.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025814363.1 | 4e-73 | GATA transcription factor 23-like | ||||
| Swissprot | Q8LC59 | 4e-17 | GAT23_ARATH; GATA transcription factor 23 | ||||
| TrEMBL | A0A2T7DM74 | 4e-73 | A0A2T7DM74_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Eb02364.1.p | 5e-88 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 2e-18 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.5NG348800.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




