![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.5NG576500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 162aa MW: 17649.8 Da PI: 6.3551 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 186.7 | 1.7e-58 | 14 | 110 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yveplk+yl+ky
Pavir.5NG576500.1.p 14 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVEPLKMYLHKY 103
69**************************************************************************************** PP
NF-YB 91 relegek 97
re+eg++
Pavir.5NG576500.1.p 104 REMEGDS 110
*****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-54 | 12 | 119 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.71E-40 | 17 | 113 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-28 | 20 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.4E-22 | 48 | 66 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 51 | 67 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.4E-22 | 67 | 85 | No hit | No description |
| PRINTS | PR00615 | 1.4E-22 | 86 | 104 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MADDGGSHEG GGGVREQDRF LPIANISRIM KKAVPANGKI AKDAKETLQE CVSEFISFVT 60 SEASDKCQKE KRKTINGDDL LWAMATLGFE EYVEPLKMYL HKYREMEGDS KLSTKAGEGS 120 VKKDAISPHG GTSSSSNQLV QHGVYNQGMG YMQPQYHNGD T* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 1e-48 | 13 | 105 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-48 | 13 | 105 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.11491 | 1e-158 | callus| leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.5NG576500.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU975758 | 0.0 | EU975758.1 Zea mays clone 499728 nuclear transcription factor Y subunit B-3 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025816143.1 | 1e-107 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | P25209 | 1e-89 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | A0A2S3HQA2 | 1e-106 | A0A2S3HQA2_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7DEX3 | 1e-105 | A0A2T7DEX3_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Eb03638.1.p | 1e-118 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 2e-70 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.5NG576500.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




