![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.5NG619500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 165aa MW: 17466.3 Da PI: 6.6734 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 176.4 | 2.8e-55 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl+kyr
Pavir.5NG619500.1.p 19 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRYLHKYR 108
89**************************************************************************************** PP
NF-YB 92 elegek 97
eleg++
Pavir.5NG619500.1.p 109 ELEGDR 114
****97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.1E-51 | 15 | 125 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.35E-39 | 21 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.5E-27 | 24 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-17 | 52 | 70 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-17 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 1.7E-17 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MADHHGQGGR GGPGAEEIKE QDRLLPIANV GRIMKQILPP NAKISKEAKE TMQECVSEFI 60 SFVTGEASDK CHKEKRKTVN GDDVCWAFGA LGFDDYVDPM RRYLHKYREL EGDRAAAAAS 120 SRGGGGSTST SAGPDAGAGA GPSSGHFMFG AMDRSDNNSS SRPF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 7e-44 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 7e-44 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 5g49_A | 7e-44 | 18 | 109 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.31516 | 0.0 | root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.5NG619500.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970198 | 1e-150 | EU970198.1 Zea mays clone 342117 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635864.1 | 4e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_015635872.1 | 4e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O82248 | 2e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A3L6SKD5 | 1e-78 | A0A3L6SKD5_PANMI; Nuclear transcription factor Y subunit B-1-like | ||||
| STRING | Pavir.Eb03826.1.p | 1e-119 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 4e-57 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.5NG619500.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




