![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.6KG269600.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 106aa MW: 11514 Da PI: 9.8826 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 55.7 | 9.7e-18 | 28 | 84 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDg++W KYG+K + +++ YY C+ +gC vk ++er+++dp+++++tY g Hnh
Pavir.6KG269600.1.p 28 LDDGFKWCKYGKKAIP--RCTNYYYWCSAEGCGVKTHMERDRDDPRYIVTTYYGVHNHA 84
59*************6..67789***********************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 3.1E-20 | 15 | 86 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.57E-17 | 20 | 86 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 21.241 | 23 | 86 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.2E-14 | 28 | 85 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.0E-13 | 29 | 83 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MMSGLAGNGG RRSSPRIGFR TRSEVGVLDD GFKWCKYGKK AIPRCTNYYY WCSAEGCGVK 60 THMERDRDDP RYIVTTYYGV HNHAVPGSGA PAAPGGGAVE RARRP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 9e-19 | 13 | 86 | 2 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 9e-19 | 13 | 86 | 2 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.6KG269600.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025818051.1 | 4e-37 | WRKY transcription factor WRKY24-like | ||||
| Swissprot | Q93WU9 | 2e-24 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | A0A1E5UKU3 | 7e-38 | A0A1E5UKU3_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Fa01143.1.p | 2e-71 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP441 | 37 | 206 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64810.1 | 2e-26 | WRKY DNA-binding protein 51 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.6KG269600.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




