![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.8NG230700.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 77aa MW: 8756.7 Da PI: 7.6014 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 59.1 | 8.3e-19 | 4 | 42 | 21 | 59 |
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+
Pavir.8NG230700.1.p 4 CRSYYRCTHQGCNVKKQVQRLSRDEAVVVTTYEGTHTHP 42
69************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 8.9E-11 | 2 | 43 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.5E-14 | 4 | 42 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.01E-15 | 4 | 43 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.5E-16 | 4 | 42 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 17.029 | 5 | 44 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MDGCRSYYRC THQGCNVKKQ VQRLSRDEAV VVTTYEGTHT HPIEKSNDNF EHILTQMQIY 60 SGMGSNFSSS SHNMFH* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.8NG230700.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728200 | 3e-83 | KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002449513.1 | 1e-45 | probable WRKY transcription factor 75 | ||||
| Refseq | XP_008678126.1 | 1e-45 | probable WRKY transcription factor 24 | ||||
| Swissprot | Q9FYA2 | 5e-29 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A3L6F4H3 | 3e-44 | A0A3L6F4H3_MAIZE; Putative WRKY transcription factor 75 | ||||
| TrEMBL | C5Y2H7 | 3e-44 | C5Y2H7_SORBI; Uncharacterized protein | ||||
| TrEMBL | K7TZX4 | 3e-44 | K7TZX4_MAIZE; Putative WRKY DNA-binding domain superfamily protein | ||||
| STRING | Pavir.J12348.1.p | 3e-48 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 2e-30 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.8NG230700.1.p |




