PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pavir.9KG458900.1.p

Organism

Panicum virgatum

Taxonomic ID

38727

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

HB-other

Protein Properties

Length: 126aa MW: 14079.8 Da PI: 4.6789

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.9KG458900.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	29.1	1.6e-09	23	55	22	54
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 +ryps ++ LA+++gL+ +qV++WF N R + Pavir.9KG458900.1.p 23 TRYPSDVDKHILARQTGLSRNQVSNWFINARVR 55 79*****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	0.0024	2	63	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.31E-13	22	66	IPR009057	Homeodomain-like
CDD	cd00086	2.80E-10	22	60	No hit	No description
PROSITE profile	PS50071	10.706	24	59	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.4E-17	25	65	IPR009057	Homeodomain-like
Pfam	PF05920	5.8E-13	25	55	IPR008422	Homeobox KN domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MPKLTLFSFL YIIVMHVQII SITRYPSDVD KHILARQTGL SRNQVSNWFI NARVRLWKPM 60 VEEMYVEEMK ADAQQQDDDG GGASCGGQQS TNPNYNPTSS DSEAADAADR GEVVEKEKIY 120 NFAFG*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pvr.15997	6e-95	leaf\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Early expression is detected in the inflorescence apex of developing flowers and also in the ovule primordium and the integuments. {ECO:0000269\|PubMed:8521490}.
Uniprot	TISSUE SPECIFICITY: Expressed in both floral and vegetative tissues. {ECO:0000269\|PubMed:8521490}.

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269\|PubMed:12244239, ECO:0000269\|PubMed:17693535, ECO:0000269\|PubMed:22786869}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.9KG458900.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK367800	2e-57	AK367800.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2062I16.
GenBank	AK372185	2e-57	AK372185.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2147N13.
GenBank	AK373089	2e-57	AK373089.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3020M01.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025793662.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793663.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793664.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793665.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793666.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793667.1	2e-35	homeobox protein BEL1 homolog
Refseq	XP_025793668.1	2e-35	homeobox protein BEL1 homolog
Swissprot	Q38897	1e-23	BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBL	A0A2S3IUU8	5e-34	A0A2S3IUU8_9POAL; Uncharacterized protein
STRING	Pavir.Ib00072.1.p	6e-54	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP7715	31	46

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G41410.1	2e-25	TALE family protein

Link Out ? help Back to Top
Phytozome	Pavir.9KG458900.1.p

Publications ? help Back to Top
Yamada T,Sasaki Y,Hashimoto K,Nakajima K,Gasser CS CORONA, PHABULOSA and PHAVOLUTA collaborate with BELL1 to confine WUSCHEL expression to the nucellus in Arabidopsis ovules. Development, 2016. 143(3): p. 422-6 [PMID:26700684] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171]