![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.9NG206100.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 80aa MW: 8933.43 Da PI: 10.2892 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 44 | 3.9e-14 | 29 | 78 | 33 | 84 |
-SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84
+ + ++ g++W+ ++ + +++++ +l +GW +F+++ngL++gD+++F l
Pavir.9NG206100.1.p 29 G-QAVVLECMGKTWKTQMVIHNGRRW-FLNGGWAKFARDNGLRVGDICLFDL 78
3.45666679********77777766.6999*******************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.266 | 1 | 79 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 4.85E-14 | 1 | 76 | No hit | No description |
| Gene3D | G3DSA:2.40.330.10 | 2.6E-17 | 6 | 78 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 4.9E-15 | 12 | 78 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 8.2E-12 | 19 | 78 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MKNNNVGDAQ KWMLELGVRY AAVHLPASGQ AVVLECMGKT WKTQMVIHNG RRWFLNGGWA 60 KFARDNGLRV GDICLFDLK* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.37568 | 1e-58 | callus | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.9NG206100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025797620.1 | 2e-53 | B3 domain-containing protein Os03g0619800-like isoform X3 | ||||
| Swissprot | Q6AV22 | 3e-19 | Y3196_ORYSJ; B3 domain-containing protein Os03g0619600 | ||||
| TrEMBL | A0A2S3IK60 | 1e-52 | A0A2S3IK60_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ia01277.1.p | 8e-54 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP585 | 31 | 172 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G33280.1 | 4e-07 | B3 family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.9NG206100.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




