PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pavir.9NG475000.1.p

Organism

Panicum virgatum

Taxonomic ID

38727

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

Trihelix

Protein Properties

Length: 137aa MW: 13442.6 Da PI: 4.4622

Description

Trihelix family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.9NG475000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	trihelix	36.9	9.4e-12	101	136	1	36
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevsk 36 rW++qe+l+L+++r+em+ ++r++ lk+plWe+vs+ Pavir.9NG475000.1.p 101 RWPRQETLELLKIRSEMDAAFRDATLKGPLWEQVSR 136 8*********************************96 PP

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MQQQHGGGGG GGGGGGGGGP AQQFGAQQVE MPPPFSPAGG AGQRISLAEA PSPISSRPPA 60 PAQQYDELGA SSAGAGSFDA EGLAAAAAGE EGASGGSAGN RWPRQETLEL LKIRSEMDAA 120 FRDATLKGPL WEQVSR*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in siliques, and, to a lower extent, in growing root hairs, leaves, stems, and flowers. Present in abaxial epidermal cells, predominantly in guard cells, pavement cells, and meristemoids. {ECO:0000269\|PubMed:21169508, ECO:0000269\|PubMed:9501260}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269\|PubMed:19717615, ECO:0000269\|PubMed:21169508}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.9NG475000.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by water stress. {ECO:0000269\|PubMed:21169508}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT061205	1e-117	BT061205.1 Zea mays full-length cDNA clone ZM_BFb0123A12 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025794485.1	9e-58	trihelix transcription factor GTL1-like isoform X2
Swissprot	Q9C882	1e-19	GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBL	A0A2T7C4N9	2e-56	A0A2T7C4N9_9POAL; Uncharacterized protein
TrEMBL	A0A2T8I1S4	2e-56	A0A2T8I1S4_9POAL; Uncharacterized protein
TrEMBL	A0A3L6TN42	4e-56	A0A3L6TN42_PANMI; Trihelix transcription factor GTL1
STRING	Pavir.Ia01419.1.p	2e-87	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP15223	12	18

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G33240.1	7e-16	GT-2-like 1

Link Out ? help Back to Top
Phytozome	Pavir.9NG475000.1.p

Publications ? help Back to Top
Caro E,Desvoyes B,Gutierrez C GTL1 keeps cell growth and nuclear ploidy under control. EMBO J., 2012. 31(24): p. 4483-5 [PMID:23188085] Zheng X, et al. The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development. Sci Rep, 2016. 6: p. 27042 [PMID:27245096] Shibata M, et al. GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis. Development, 2018. [PMID:29439132]